Connecting to LinkedIn...

W1siziisijiwmtyvmtavmtmvmtavmtkvmtcvndgwlziuanbnil0swyjwiiwidgh1bwiilcixotiwedk1mcmixv0

AI Engineer – Dublin

This job has expired

Job Title: AI Engineer – Dublin
Contract Type: Permanent
Location: Dublin
Industry:
Salary:
Start Date:
Duration:
REF: JN -012019-2836
Contact Name:
Contact Email:
Job Veröffentlicht: 2 maanden geleden

Job Description

We’re looking for passionate and motivated AI Engineer here in Dublin, Ireland for those who have a strong background in C++, AI or Machine Learning. 
Once you have a Masters degree in computer science/engineering or similar discipline, we would love to talk. 
Interested to know more? Talk to us today.

Your Tasks:
  •  You will provide AI-based solutions and the tools needed to maintain the safety and integrity of the companies services. 
  •  You will help in the implementation of AI-Algorithms for various online gaming types.
  • You will help in the creation of full flexible AI agents and extend a suite of online gaming theory for the best analysis tools. 
  • Work with various other departments throughout the company on AI-based solutions.
  • Working closely with the small team and develop AI-based solutions

Our Client:
Work for a company that was originally a family fun business that has grown rapidly due to a high volume of demand for their services. They now operate internationally with over 400 employees and offices in Malta, the UK, and Ireland. 

Main Requirements:
You will need the following to qualify for this job: 
  • Master’s degree in computer science/engineering/similar discipline
  • Strong C++ Skills
  • Experience in deep learning/machine learning and applying the technologies
  • Experience with game theory 
  • Experience with Java, C#, and SQL desirable
  • Know your way with distributed computation in clusters, multicore environments 
  • Near-native level of English
  • Excellent communication skills
  • Team player
  • Strong interest in Artificial Intelligence (where you constantly keep yourself up to date with new tech & developments in the AI Domain).
  • Interest in Poker is a plus
  • Passion for all things Tech

Where is the job located?
Dublin – Ireland –
live & work on 30 mins drive from Dublin city center where you are never too far from the action. There is always something to do – whether you like suburban life or a city bird you have the best of both worlds here. 

Interview & Salary: 
First, there will a phone screening with the HR Manager and the Lead developer, a face-to-face interview with the hiring manager here in Dublin. There is some flexibility involved – if you are not currently living in Ireland, we can advise towards a Skype interview instead. 
Salary: You can expect to earn €47,000 - €66,000 gross per annum. This is, of course, dependant on your level of experience and skill. 
There is a good relocation package of a one-off payment of up to €3,000 as well as a number of great company benefits (private healthcare, dental and much more)


Keywords: C++, Machine learning, Artificial Intelligence, Deep learning, AI Engineer, AI Research Engineer, Tech Jobs Dublin,Java, C#, SQL
 
 
  • De kandidaten die Careertrotter aan ons voorstelt zijn altijd van hoog niveau - Klant in Dublin
  • Roel: met Careertrotter’s hulp zal je veel sneller een leuke baan in het buitenland vinden!
  • Bij Careertrotter werken wij allemaal in het buitenland, dus we weten waar je tegenaan loopt